Home/GT Families/GT31/C1GALT1C1
C1GALT1C1
Homo sapiens · C1GALT1-specific chaperone 1
GT31Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
|---|
| Gene symbol | C1GALT1C1 |
|---|
| Synonyms / alternate names | - COSMC
- C38H2-like protein 1
- Core 1 beta1,3-galactosyltransferase 2
- Core 1 beta3-galactosyltransferase-specific molecular chaperone
|
|---|
| UniProt accession | Q96EU7 |
|---|
| NCBI Gene ID | 29071 |
|---|
| Source species | Homo sapiens |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | C1GALT1-specific chaperone 1 |
|---|
| Subcellular location | Membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | Associates with core 1 beta-3-galactosyltransferase (C1GALT1 |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
318 aa
MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND
Catalytic domain sequence
not curated
