Home/GT Families/GT31/Mfng
Mfng
Mus musculus · Beta-1,3-N-acetylglucosaminyltransferase manic fringe (EC 2.4.1.222)
GT31Non-model organism · annotation 4–5Fold GT-AInverting2 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
|---|
| Gene symbol | Mfng |
|---|
| Synonyms / alternate names | O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
|---|
| UniProt accession | O09008 |
|---|
| NCBI Gene ID | 17305 |
|---|
| Source species | Mus musculus |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Beta-1,3-N-acetylglucosaminyltransferase manic fringe (EC 2.4.1.222) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | 2J0A, 2J0B |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | - 3-O-(alpha-L-fucosyl)-L-threonyl-[EGF-like domain protein]
- 3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein]
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
321 aa
MHCRLFRGMAGALFTLLCVGLLSLRYHSSLSQRMIQGALRLNQRNPGPLELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTNCSAEHSHPALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLLAAP
Catalytic domain sequence
116 aa
KMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGY
