GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

bre-5

Caenorhabditis elegans · Beta-1,3-galactosyltransferase bre-5 (EC 2.4.1.-)

GT31Model organism · annotation ≥ 4Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT31 · CAZy entry
Gene symbolbre-5
Synonyms / alternate namesBacillus thuringiensis toxin-resistant protein 5
UniProt accessionQ95US5
NCBI Gene ID178142
Source speciesCaenorhabditis elegans
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionBeta-1,3-galactosyltransferase bre-5 (EC 2.4.1.-)
Subcellular locationGolgi apparatus membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donornot curated
Donor CCD code(s)not curated
Acceptor substrate(s)not curated
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

322 aa
MFLCVRILKRKYHELSSFQKLLIFTITIFLLWVLGVVDKFRETSFGDFSWPLETRNLQLRSKFTKYPQCKFSGNGQKIIIIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHNENFIFWCRRVSQKEWDDGVIAVHGYARKDLEYEYSQLNGFE

Catalytic domain sequence

189 aa
RESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHN