Home/GT Families/GT31/bre-5
bre-5
Caenorhabditis elegans · Beta-1,3-galactosyltransferase bre-5 (EC 2.4.1.-)
GT31Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
| Gene symbol | bre-5 |
| Synonyms / alternate names | Bacillus thuringiensis toxin-resistant protein 5 |
| UniProt accession | Q95US5 |
| NCBI Gene ID | 178142 |
| Source species | Caenorhabditis elegans |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Beta-1,3-galactosyltransferase bre-5 (EC 2.4.1.-) |
| Subcellular location | Golgi apparatus membrane |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Inverting |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
| Donor CCD code(s) | not curated |
| Acceptor substrate(s) | not curated |
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
322 aa
MFLCVRILKRKYHELSSFQKLLIFTITIFLLWVLGVVDKFRETSFGDFSWPLETRNLQLRSKFTKYPQCKFSGNGQKIIIIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHNENFIFWCRRVSQKEWDDGVIAVHGYARKDLEYEYSQLNGFE
Catalytic domain sequence
189 aa
RESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVFTGILAKTVNVAATHN