GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

brn

Drosophila melanogaster · Beta-1,4-mannosylglycolipid beta-1,3-N-acetylglucosaminyltransferase brn (EC 2.4.1.-)

GT31Model organism · annotation ≥ 4Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT31 · CAZy entry
Gene symbolbrn
Synonyms / alternate names
  • Glycolipid-specific beta-1,3-N-Acetylglucosaminyltransferase brn
  • Neurogenic secreted-signaling protein brn
  • Protein brainiac
  • UDP-GlcNAc:beta-Man/beta-Gal beta-1,3GlcNAc transferase
UniProt accessionQ24157
NCBI Gene ID31358
Source speciesDrosophila melanogaster
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionBeta-1,4-mannosylglycolipid beta-1,3-N-acetylglucosaminyltransferase brn (EC 2.4.1.-)
Subcellular locationGolgi apparatus membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceYes (Mg2+)
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorUDP-N-acetyl-alpha-D-glucosamine
Donor CCD code(s)UD1
Acceptor substrate(s)beta-D-Man-(1->4)-beta-D-Glc-(1<->1)-ceramide
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

325 aa
MQSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVWNECRSANYA

Catalytic domain sequence

190 aa
RRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHC