Home/GT Families/GT31/c1galt1
c1galt1
Xenopus laevis · Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 (EC 2.4.1.122)
GT31Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
|---|
| Gene symbol | c1galt1 |
|---|
| Synonyms / alternate names | - Core 1 O-glycan T-synthase
- Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1
- Core 1 beta1,3-galactosyltransferase 1
|
|---|
| UniProt accession | Q6GNL1 |
|---|
| NCBI Gene ID | 444326 |
|---|
| Source species | Xenopus laevis |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 (EC 2.4.1.122) |
|---|
| Subcellular location | Membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | homodimer |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
|---|
| Donor CCD code(s) | GDU |
|---|
| Acceptor substrate(s) | an N-acetyl-alpha-D-galactosaminyl derivative |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
360 aa
MSIICAKVAWLPLTLGTAMGFLITFYLARTLLERNSQPPLALRSWNNMELLPEVGMSHFHLPEDNSVSEELSKKVRVLCWIMTGPTNLKTKAIHVKNSWTRHCNVALFMSSITDEDFPAIGLGTGEGRDKLYWKTIRAFHYAHKYYLNETEWFFKADDDTYVIMDNLRWMLSNYTADQPIYFGKRFKPYIKQGYMSGGAGYVLSREALIRFVEGFRTGVCKHTTSTEDVAIGNCMQLMGVIAGDSRDTEKRETFHPFPPEHHLTMKFSESKSFWYWSYCVYPIVEGPQCCSDLAISFHYISPEDMYTLEYFIYHLRAHGYQYRYQPPLSDNADNLPVYIENETVKPNRTISDFLEPPMES
Catalytic domain sequence
100 aa
YAHKYYLNETEWFFKADDDTYVIMDNLRWMLSNYTADQPIYFGKRFKPYIKQGYMSGGAGYVLSREALIRFVEGFRTGVCKHTTSTEDVAIGNCMQLMGV
