GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

CSH1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) · Mannosyl phosphorylinositol ceramide synthase CSH1 (EC 2.4.1.370)

GT32Model organism · annotation ≥ 4Fold GT-ARetaining

External resources

Identification and annotation

CAZy familyGT32 · CAZy entry
Gene symbolCSH1
Synonyms / alternate namesCSG1/SUR1 homolog 1
UniProt accessionP38287
NCBI Gene ID852458
Source speciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c)
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionMannosyl phosphorylinositol ceramide synthase CSH1 (EC 2.4.1.370)
Subcellular locationVacuole membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismRetaining
Cation dependenceYes (Mn2+)
Oligomeric stateheterodimer
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorGDP-alpha-D-mannose
Donor CCD code(s)GDD
Acceptor substrate(s)a 1D-myo-inositol-1-phospho-N-[(R)-2-hydroxy-very-long-chain fatty acyl]-(R)-4-hydroxysphingoid base
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

376 aa
MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQLIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLCSGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDSVFLDIEKNHAKFTDLT

Catalytic domain sequence

84 aa
PEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLK