GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

SPCC4F11.04c

Schizosaccharomyces pombe (strain 972 / ATCC 24843) · Inositol phosphoceramide mannosyltransferase 2 (EC 2.4.-.-)

GT32Non-model organism · annotation 4–5Fold GT-ARetaining

External resources

Identification and annotation

CAZy familyGT32 · CAZy entry
Gene symbolSPCC4F11.04c
Synonyms / alternate namesIPC mannosyltransferase 2
UniProt accessionQ9UT67
NCBI Gene IDnot curated
Source speciesSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Taxonomic domainEukaryota
UniProt annotation level4

Function and localisation

Enzyme functionInositol phosphoceramide mannosyltransferase 2 (EC 2.4.-.-)
Subcellular location
  • Golgi apparatus, cis-Golgi network membrane
  • Golgi apparatus, trans-Golgi network membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismRetaining
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donornot curated
Donor CCD code(s)not curated
Acceptor substrate(s)not curated
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

345 aa
MVKVIYKFAVFAAVNFFLMSSIVLYFNNEFLMFADRCTKDIIPSEELRYLRQVLNDSIPSKDEPLPTLKLDSLNDISGEPVIPKIIHQTWKTTEVPEGWKGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLLYYPVWVRRTDPVGVSNDVMGSVPHHPYFELIIQNLEKNAKSYWLPYLTIMLSTGPLSISFLWEKYKRQLPNPPAFYDHIRVLLERDYKFSNDSYFTFYEGSSWHNNDAGIILWANRHLAYVIVAGFCLYFILSYMFFSKLLDSRYVQRFVTSKRKQPTLPLALQEDV

Catalytic domain sequence

83 aa
PEGWKGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLL