Home/GT Families/GT32/imt1
imt1
Schizosaccharomyces pombe (strain 972 / ATCC 24843) · Inositol phosphoceramide mannosyltransferase 1 (EC 2.4.-.-)
GT32Non-model organism · annotation 4–5Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT32 · CAZy entry |
|---|
| Gene symbol | imt1 |
|---|
| Synonyms / alternate names | IPC mannosyltransferase 1 |
|---|
| UniProt accession | O14084 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Inositol phosphoceramide mannosyltransferase 1 (EC 2.4.-.-) |
|---|
| Subcellular location | - Golgi apparatus, cis-Golgi network membrane
- Golgi apparatus, trans-Golgi network membrane
|
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
319 aa
MGRKCRKLLLKGIPICGVILLILWGYSLYNTLRFMVPGKATEPFTLSLSDVSDDTSAPGEMEKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPSTEPIGYSNDWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLSYQFCKYLLTPHEPVRVLPALLYGNGPNSFFSHVTGDSWHGTDAKVFIWIDRNSKSVLFFAFLAAFAILFLCLRVVFKRRRKRGIAASHSQIQELYP
Catalytic domain sequence
91 aa
PERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATF
