Home/GT Families/GT32/och1
och1
Schizosaccharomyces pombe (strain 972 / ATCC 24843) · Initiation-specific alpha-1,6-mannosyltransferase (EC 2.4.1.232)
GT32Non-model organism · annotation 4–5Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT32 · CAZy entry |
|---|
| Gene symbol | och1 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q9UTR6 |
|---|
| NCBI Gene ID | 2543147 |
|---|
| Source species | Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Initiation-specific alpha-1,6-mannosyltransferase (EC 2.4.1.232) |
|---|
| Subcellular location | - Endoplasmic reticulum membrane
- Golgi apparatus membrane
|
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
396 aa
MLRLRLRSIVIGAAIAGSILLLFNHGSIEGMEDLTEISMLEDYTPEAANKDYVGQQEEEELLYDQPSYIEEEEDPDLEAYLSDLEREELEHSLEELDEENNYKLHLRYSFSQLQDFDEENEAVHMIVPKDTYEFEVPYHADIPKLIWQTSKDPFDREVMKYTRFWRINHPSYSHAVLDDEQSKALVISSFGDSSVSKISQAYAMMPLPVLKADFFRYLVLLAKGGIYSDIDTAPLKHINNWIPREYRKRNIRLIVGIEADPDRPDWNDYYARRVQFCQWTIAAAPGHPILWELVRRITDETWKLHDSKKLSKNGESVMEWTGPGIWTDAIMDYLNWQYGPFSVENITNLEEPYLVGDVLILPITAFSPGVGHMGSKSPNDPMAYVQHFFAGSWKDD
Catalytic domain sequence
91 aa
REVMKYTRFWRINHPSYSHAVLDDEQSKALVISSFGDSSVSKISQAYAMMPLPVLKADFFRYLVLLAKGGIYSDIDTAPLKHINNWIPREY
