Home/GT Families/GT39/tw
tw
Drosophila melanogaster · Protein O-mannosyl-transferase 2 (EC 2.4.1.109)
GT39Model organism · annotation ≥ 4Fold GT-CInverting
External resources
Identification and annotation
| CAZy family | GT39 · CAZy entry |
|---|
| Gene symbol | tw |
|---|
| Synonyms / alternate names | - Pomt2
- Dolichyl-phosphate-mannose--protein mannosyltransferase 2
- Protein twisted
|
|---|
| UniProt accession | Q9W5D4 |
|---|
| NCBI Gene ID | 31024 |
|---|
| Source species | Drosophila melanogaster |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Protein O-mannosyl-transferase 2 (EC 2.4.1.109) |
|---|
| Subcellular location | Endoplasmic reticulum membrane |
|---|
Structure and mechanism
| Fold type | GT-C |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Interacts with Rt/POMT1 |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | - a di-trans,poly-cis-dolichyl beta-D-mannosyl phosphate
- L-seryl-[protein]
- L-threonyl-[protein]
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
765 aa
MAASVVKTPKCPRRGSVKDVAQNAPRTAPTSSKEANWNWWLLLATVFLVTFATRFYKVTEPDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNETRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLAAAYLIFDVGLLTLNQYILLDPILLFFMMASVWGMVKVSKSTASGGSYGLRWWLWLFLTGTMLSCTISVKFVGLFVVLLVGLHTATELWLILGDLGQPILETVKQLACRAITLIVWPVLLYILFFYIHLSVLNRSGNGDGFYSSAFQSRLIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHHHLYPKGSGARQQQVTTYTHKDENNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQVTGYGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGKQLPKWGFEQQEVSCNPNVRDKNSQWNVEDNEHKLMPSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKEGEVTSRPWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLALFVTVFLCNAVVQQRRAGFARSAAQNQAQVPDSETVAQDEESEHSTTDICSCCTPAKEIVPKAVPSGSPEAPNPAQSLRAAAWLFLGWMLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMYNYILRVLPKWIHHVILGLVLSILVYSFAAFSPLAYGMSGPLANEPNSTMYNLKWLSTWEF
Catalytic domain sequence
246 aa
FFARFLESHAVMLQGNAGLKPKEGEVTSRPWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLALFVTVFLCNAVVQQRRAGFARSAAQNQAQVPDSETVAQDEESEHSTTDICSCCTPAKEIVPKAVPSGSPEAPNPAQSLRAAAWLFLGWMLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMYNYILRVLPKWIHHVILGLVLSILVYSFAAFSPLAYGMSGPLANEPNSTMYNLKWLSTW
