Home/GT Families/GT4/pimA
pimA
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) · Phosphatidyl-myo-inositol mannosyltransferase (EC 2.4.1.345)
GT4Non-model organism · annotation 4–5Fold GT-BRetaining
External resources
Identification and annotation
| CAZy family | GT4 · CAZy entry |
| Gene symbol | pimA |
| Synonyms / alternate names | - Alpha-mannosyltransferase
- GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
- Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase
- Phosphatidylinositol alpha-mannosyltransferase
|
| UniProt accession | P9WMZ5 |
| NCBI Gene ID | 45426613; 888627 |
| Source species | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic domain | Bacteria |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Phosphatidyl-myo-inositol mannosyltransferase (EC 2.4.1.345) |
| Subcellular location | not curated |
Structure and mechanism
| Fold type | GT-B |
| Catalytic mechanism | Retaining |
| Cation dependence | Yes (Mg2+) |
| Oligomeric state | monomer |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | GDP-alpha-D-mannose |
| Donor CCD code(s) | GDD |
| Acceptor substrate(s) | - a 1
- 2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol)
|
| Acceptor CCD / GlycoCT | INS Verified PDB CCD code |
Protein sequences
Full protein sequence
378 aa
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS
Catalytic domain sequence
364 aa
RIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYE