GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

pimA

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) · Phosphatidyl-myo-inositol mannosyltransferase (EC 2.4.1.345)

GT4Non-model organism · annotation 4–5Fold GT-BRetaining

External resources

Identification and annotation

CAZy familyGT4 · CAZy entry
Gene symbolpimA
Synonyms / alternate names
  • Alpha-mannosyltransferase
  • GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
  • Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase
  • Phosphatidylinositol alpha-mannosyltransferase
UniProt accessionP9WMZ5
NCBI Gene ID45426613; 888627
Source speciesMycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Taxonomic domainBacteria
UniProt annotation level5

Function and localisation

Enzyme functionPhosphatidyl-myo-inositol mannosyltransferase (EC 2.4.1.345)
Subcellular locationnot curated

Structure and mechanism

Fold typeGT-B
Catalytic mechanismRetaining
Cation dependenceYes (Mg2+)
Oligomeric statemonomer
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorGDP-alpha-D-mannose
Donor CCD code(s)GDD
Acceptor substrate(s)
  • a 1
  • 2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol)
Acceptor CCD / GlycoCTINS Verified PDB CCD code

Protein sequences

Full protein sequence

378 aa
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS

Catalytic domain sequence

364 aa
RIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYE