Home/GT Families/GT4/waaG
waaG
Escherichia coli (strain K12) · Lipopolysaccharide glucosyltransferase WaaG (EC 2.4.1.-)
GT4Model organism · annotation ≥ 4Fold GT-BRetaining3 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT4 · CAZy entry |
|---|
| Gene symbol | waaG |
|---|
| Synonyms / alternate names | - pcsA
- rfaG
- Lipopolysaccharide glucosyltransferase I
- UDP-glucose:(heptosyl)lipopolysaccharide glucosyltransferase
|
|---|
| UniProt accession | P25740 |
|---|
| NCBI Gene ID | 948149 |
|---|
| Source species | Escherichia coli (strain K12) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Lipopolysaccharide glucosyltransferase WaaG (EC 2.4.1.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | 2IV7, 2IW1, 2N58 |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
374 aa
MIVAFCLYKYFPFGGLQRDFMRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHTNHGRNAEYYAWVQNHLKEHPADRVVGFNKMPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYRHYAAFERATFEQGKSTKLMMLTDKQIADFQKHYQTEPERFQILPPGIYPDRKYSEQIPNSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARHYADTQDLYSLPEKAADIITGGLDG
Catalytic domain sequence
168 aa
REIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARH
