Home/GT Families/GT47/rib-1
rib-1
Caenorhabditis elegans · Exostosin-1 homolog
GT47Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT47 · CAZy entry |
|---|
| Gene symbol | rib-1 |
|---|
| Synonyms / alternate names | - Multiple exostoses homolog 1
- Related to mammalian RIB protein 1
|
|---|
| UniProt accession | O01704 |
|---|
| NCBI Gene ID | 178080 |
|---|
| Source species | Caenorhabditis elegans |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Exostosin-1 homolog |
|---|
| Subcellular location | - Endoplasmic reticulum
- Golgi apparatus
|
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Interacts with rib-2 |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
382 aa
MQNVMKFHLVIFMLFGSVRLQNPTIERKQCTMSNCFDFSKCSTSKKVYIHPMEKRFEESPQSVIYSKILKHFLESNHYTNDPNEACIFLLGIDTTDRDVRSQNYVKNVNDYIESLDPSVWNNGRNHLIFNFYHGTFPDYDDHNLNFDTGEAMIARASSSENNFIKVFDVSLPLFHENHPYEIKESKSERNDDRIENQRKYLVSFKGKRYVYGIGSGTRNLVHHLHNGDDIVMVTTCKHNNDWQVYQDDRCQRDNDEYDRWEYDELLANSTFCLVPRGRRLGSFRFLETLRSGCVPVVISDSWILPFSETIDWNSAAIVVAERDALSIPELLMSTSRRRVKELRESARNVYDAYLRSIQVISDHVLRIIFKRIDNKIELEDHQ
Catalytic domain sequence
290 aa
SKKVYIHPMEKRFEESPQSVIYSKILKHFLESNHYTNDPNEACIFLLGIDTTDRDVRSQNYVKNVNDYIESLDPSVWNNGRNHLIFNFYHGTFPDYDDHNLNFDTGEAMIARASSSENNFIKVFDVSLPLFHENHPYEIKESKSERNDDRIENQRKYLVSFKGKRYVYGIGSGTRNLVHHLHNGDDIVMVTTCKHNNDWQVYQDDRCQRDNDEYDRWEYDELLANSTFCLVPRGRRLGSFRFLETLRSGCVPVVISDSWILPFSETIDWNSAAIVVAERDALSIPELLMS
