Home/GT Families/GT50/Pigm
Pigm
Rattus norvegicus · GPI alpha-1,4-mannosyltransferase I, catalytic subunit (EC 2.4.1.-)
GT50Non-model organism · annotation 4–5Fold GT-CInverting
External resources
Identification and annotation
| CAZy family | GT50 · CAZy entry |
|---|
| Gene symbol | Pigm |
|---|
| Synonyms / alternate names | - GPI mannosyltransferase I
- Phosphatidylinositol-glycan biosynthesis class M protein
|
|---|
| UniProt accession | Q9EQY6 |
|---|
| NCBI Gene ID | 79112 |
|---|
| Source species | Rattus norvegicus |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | GPI alpha-1,4-mannosyltransferase I, catalytic subunit (EC 2.4.1.-) |
|---|
| Subcellular location | Endoplasmic reticulum membrane |
|---|
Structure and mechanism
| Fold type | GT-C |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Part of the glycosylphosphatidylinositol-mannosyltransferase |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | - a 2-acyl-6-alpha-D-glucosaminyl-1-(1-radyl,2-acyl-sn-glycero-3-phospho)-1D-myo-inositol
- a di-trans,poly-cis-dolichyl beta-D-mannosyl phosphate
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
423 aa
MSYTKHWGEWFLNLRVPPAGVFGVAFLARVALVFYGVFQDRTLLVRYTDIDYHVFTDAARFVTEGRSPYLRATYRYTPLLSWLLTPNVYLSELFGKFLFISCDLLTAFLLYRLLLLKGLGRRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLTTLYLIEKRLIACAAVFYGFAVHMKMYPVTYILPIALHLRPERDSDEGLRLARYSFQARLYDFLKRLCSWAVLLFVAIAGLTFLALSFGFYYKYGWEFLEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFTLGIAAFLPQFILLSAASFAYYRDLVFCCFLHTSIFVTFNKVCTSQYFLWYLCLLPLVMPLVRMPWKRAVVLLMLWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQIISHYKEDRLTERIKYD
Catalytic domain sequence
269 aa
VSSRGNADSIVASLVLTTLYLIEKRLIACAAVFYGFAVHMKMYPVTYILPIALHLRPERDSDEGLRLARYSFQARLYDFLKRLCSWAVLLFVAIAGLTFLALSFGFYYKYGWEFLEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFTLGIAAFLPQFILLSAASFAYYRDLVFCCFLHTSIFVTFNKVCTSQYFLWYLCLLPLVMPLVRMPWKRAVVLLMLWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQII
