Home/GT Families/GT6/Gbgt1
Gbgt1
Mus musculus · Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 (EC 2.4.1.88)
GT6Non-model organism · annotation 4–5Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT6 · CAZy entry |
| Gene symbol | Gbgt1 |
| Synonyms / alternate names | - Fgs
- Forssman glycolipid synthase
|
| UniProt accession | Q8VI38 |
| NCBI Gene ID | 227671 |
| Source species | Mus musculus |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 (EC 2.4.1.88) |
| Subcellular location | Golgi apparatus membrane |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Retaining |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-galactosamine |
| Donor CCD code(s) | UD2 |
| Acceptor substrate(s) | - a globoside Gb4Cer (d18:1(4E))
- a globoside Gb4Cer
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
347 aa
MTRPRLAQGLAFFLLGGTGLWVLWKFIKDWLLVSYIPYYLPCPEFFNMKLPFRKEKPLQPVTQLQYPQPKLLEHGPTELLTLTPWLAPIVSEGTFDPELLKSMYQPLNLTIGVTVFAVGKYTCFIQRFLESAEEFFMRGYQVHYYLFTHDPTAVPRVPLGPGRLLSIIPIQGYSRWEEISMRRMETINKHIAKRAHKEVDYLFCVDVDMVFRNPWGPETLGDLVAAIHPGYFAVPRRKFPYERRQVSSAFVADNEGDFYYGGALFGGRVARVYEFTRACHMAILADKANSIMAAWQEESHLNRHFIWHKPSKVLSPEYLWDERKPRPRSLKMIRFSSVKKNANWLRT
Catalytic domain sequence
288 aa
QPVTQLQYPQPKLLEHGPTELLTLTPWLAPIVSEGTFDPELLKSMYQPLNLTIGVTVFAVGKYTCFIQRFLESAEEFFMRGYQVHYYLFTHDPTAVPRVPLGPGRLLSIIPIQGYSRWEEISMRRMETINKHIAKRAHKEVDYLFCVDVDMVFRNPWGPETLGDLVAAIHPGYFAVPRRKFPYERRQVSSAFVADNEGDFYYGGALFGGRVARVYEFTRACHMAILADKANSIMAAWQEESHLNRHFIWHKPSKVLSPEYLWDERKPRPRSLKMIRFSSVKKNANWLR