Home/GT Families/GT7/b4galt7
b4galt7
Danio rerio · Beta-1,4-galactosyltransferase (EC 2.4.1.-)
GT7Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT7 · CAZy entry |
|---|
| Gene symbol | b4galt7 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q6DRL9 |
|---|
| NCBI Gene ID | 445022 |
|---|
| Source species | Danio rerio |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Beta-1,4-galactosyltransferase (EC 2.4.1.-) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
|---|
| Donor CCD code(s) | GDU |
|---|
| Acceptor substrate(s) | 3-O-(beta-D-xylosyl)-L-seryl-[protein] |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
317 aa
MMYSSRRKPVLYFKDERSFLSRKCTVWKLFGLCMVFVFGSLLWVQLTCTGDMSQTAGYSHLPQQPCPIDKQSSHVDDPSWGPHKMALIVPFRERFEELLVFVPYMHAFLNKKKIRHKIFIINQVDHFRFNRASLINVGFMESGNDTDYIAMHDVDLLPQNEDLNYGFPVDGPFHVASPELHPLYHYKTYVGGILLLTKKHYLACNGMSNRFWGWGRENDEFFRRLKAANLELFRPTGITTGTKTFRHIHDPAWRKRDQKRIAAQKQEQFKVDPEGGLSNLRYKVESRKEVSISGAPCTVINTFVECDLNQTPWCQFS
Catalytic domain sequence
224 aa
PHKMALIVPFRERFEELLVFVPYMHAFLNKKKIRHKIFIINQVDHFRFNRASLINVGFMESGNDTDYIAMHDVDLLPQNEDLNYGFPVDGPFHVASPELHPLYHYKTYVGGILLLTKKHYLACNGMSNRFWGWGRENDEFFRRLKAANLELFRPTGITTGTKTFRHIHDPAWRKRDQKRIAAQKQEQFKVDPEGGLSNLRYKVESRKEVSISGAPCTVINTFVE
