GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

GYG2

Homo sapiens · Glycogenin-2 (EC 2.4.1.186)

GT8Model organism · annotation ≥ 4Fold GT-ARetaining2 PDB structure(s)

External resources

Identification and annotation

CAZy familyGT8 · CAZy entry
Gene symbolGYG2
Synonyms / alternate namesnot curated
UniProt accessionO15488
NCBI Gene ID8908
Source speciesHomo sapiens
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionGlycogenin-2 (EC 2.4.1.186)
Subcellular location
  • Cytoplasm
  • Nucleus

Structure and mechanism

Fold typeGT-A
Catalytic mechanismRetaining
Cation dependenceYes (Mn2+)
Oligomeric statehomodimer
PDB structures4UEG, 8Z0A

Donor and acceptor specificity

Sugar nucleotide donorUDP-alpha-D-glucose
Donor CCD code(s)UPG
Acceptor substrate(s)
  • L-tyrosyl-[glycogenin]
  • [1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin]
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

501 aa
MSETEFHHGAQAGLELLRSSNSPTSASQSAGMTVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ

Catalytic domain sequence

216 aa
VTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNY