Home/GT Families/GT8/waaJ
waaJ
Escherichia coli · Lipopolysaccharide 1,2-glucosyltransferase (EC 2.4.1.58)
GT8Model organism · annotation ≥ 4Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT8 · CAZy entry |
|---|
| Gene symbol | waaJ |
|---|
| Synonyms / alternate names | - UDP-glucose:(galactosyl) LPS alpha 1
- 2-glucosyltransferase
|
|---|
| UniProt accession | Q9ZIT6 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Escherichia coli |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Lipopolysaccharide 1,2-glucosyltransferase (EC 2.4.1.58) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mg2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-glucose |
|---|
| Donor CCD code(s) | UPG |
|---|
| Acceptor substrate(s) | [lipopolysaccharide] |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
339 aa
MKLDFKHLTQFKDIIELDKRPVKLDERETFNVSWGIDENYQVGAAISIASILENNKQNKFTFHIIADYLDKEYIELLSQLATKYQTVIKLYLIDSEPLKALPQSNIWPVSIYYRLLSFDYFSARLDSLLYLDADIVCKGSLNELIALEFKDEYGAVVIDVDAMQSKSAERLCNEDFNGSYFNSGVMYINLREWLKQRLTEKFFDLLSDESIIKKLKYPDQDILNLMFLHHAKILPRKYNCIYTIKSEFEEKNSEYYTRFINDDTVFIHYTGITKPWHDWANYASADYFRNIYNISPWRNIPYKKAVKKHEHKEKYKHLLYQKKFLDGVFTAIKYNVMKG
Catalytic domain sequence
250 aa
NVSWGIDENYQVGAAISIASILENNKQNKFTFHIIADYLDKEYIELLSQLATKYQTVIKLYLIDSEPLKALPQSNIWPVSIYYRLLSFDYFSARLDSLLYLDADIVCKGSLNELIALEFKDEYGAVVIDVDAMQSKSAERLCNEDFNGSYFNSGVMYINLREWLKQRLTEKFFDLLSDESIIKKLKYPDQDILNLMFLHHAKILPRKYNCIYTIKSEFEEKNSEYYTRFINDDTVFIHYTGITKPWHDWA
