Home/GT Families/GT81/gpgS
gpgS
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) · Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266)
GT81Non-model organism · annotation 4–5Fold GT-ARetaining14 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT81 · CAZy entry |
|---|
| Gene symbol | gpgS |
|---|
| Synonyms / alternate names | Retaining glucosyltransferase |
|---|
| UniProt accession | P9WMW9 |
|---|
| NCBI Gene ID | 45425178; 886085 |
|---|
| Source species | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mg2+, Ca2+, Mn2+) |
|---|
| Oligomeric state | homodimer |
|---|
| PDB structures | 3E25, 3E26, 4DDZ, 4DE7, 4DEC, 4Y6N, 4Y6U, 4Y7F, 4Y7G, 4Y9X, 5JQQ, 5JQX, 5JT0, 5JUC |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | - an NDP-alpha-D-glucose
- UDP-alpha-D-glucose
|
|---|
| Donor CCD code(s) | UPG |
|---|
| Acceptor substrate(s) | (2R)-3-phosphoglycerate |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
324 aa
MTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDDSDYTRHTWPVSLVDRPPMKVMRPR
Catalytic domain sequence
105 aa
SVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVG
