Home/GT Families/GT81/gpgS
gpgS
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) · Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266)
GT81Non-model organism · annotation 4–5Fold GT-ARetaining1 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT81 · CAZy entry |
|---|
| Gene symbol | gpgS |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q7U0E1 |
|---|
| NCBI Gene ID | 45425178 |
|---|
| Source species | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mg2+, Mn2+) |
|---|
| Oligomeric state | homotrimer |
|---|
| PDB structures | 5JUD |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | - an NDP-alpha-D-glucose
- UDP-alpha-D-glucose
- ADP-alpha-D-glucose
- GDP-D-glucose
|
|---|
| Donor CCD code(s) | UPG, ADQ, GDG |
|---|
| Acceptor substrate(s) | (2R)-3-phosphoglycerate |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
324 aa
MTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDDSDYTRHTWPVSLVDRPPMKVMRPR
Catalytic domain sequence
105 aa
SVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVG
