Home/GT Families/GT2/MG335.2
MG335.2
Mycoplasmoides genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) · Processive diacylglycerol beta-glycosyltransferase (EC 2.4.1.-)
GT2Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT2 · CAZy entry |
|---|
| Gene symbol | MG335.2 |
|---|
| Synonyms / alternate names | - Beta-diglycosyldiacylglycerol synthase
- Beta-monoglycosyldiacylglycerol synthase
- Glycosyl-beta-1,6-glycosyldiacylglycerol synthase
- UDP-galactose:1,2-dioleoylglycerol 3-beta-D-galactosyltransferase
- UDP-glucose:1,2-dioleoylglycerol 3-beta-D-glucosyltransferase
|
|---|
| UniProt accession | Q9ZB73 |
|---|
| NCBI Gene ID | 99647228 |
|---|
| Source species | Mycoplasmoides genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Processive diacylglycerol beta-glycosyltransferase (EC 2.4.1.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mg2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | - UDP-alpha-D-glucose
- UDP-alpha-D-galactose
|
|---|
| Donor CCD code(s) | UPG, GDU |
|---|
| Acceptor substrate(s) | - a 1,2-diacyl-sn-glycerol
- a 1,2-diacyl-3-O-(beta-D-glucopyranosyl)-sn-glycerol
- a 1,2-diacyl-3-O-(beta-D-galactosyl)-sn-glycerol
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
341 aa
MDKLVSILVPCYKSKPFLKRFFNSLLKQDLNQAKIIFFNDNVADETYEVLQKFKKEHNNLAIEVYCDKQNEGIGKVRDKLVNLVTTPYFYFIDPDDCFNNKNVIKEIVESIKKEDFDLGVLKSMVYLCFLKHDFIIKFLPLKGIFQGRVKLINNNNVNKLNYIKNNDQYIWNIVINTDFFRKLNLTFESRLFEDIPIWYPMFFSSQKIVFIDVIGTNYFIRNDSLSTTISAPRYLNLIQCYEKLYVNLSQNGSLASFIDPNHKIEARFWRRQMFVWFALFSFEYFKKNFSESKKILEKLFVFLEKNGVYERVFQTKNQGIYYIWVQRLKYFKHVLESKSDN
Catalytic domain sequence
121 aa
SILVPCYKSKPFLKRFFNSLLKQDLNQAKIIFFNDNVADETYEVLQKFKKEHNNLAIEVYCDKQNEGIGKVRDKLVNLVTTPYFYFIDPDDCFNNKNVIKEIVESIKKEDFDLGVLKSMVY
