Home/GT Families/GT2/glfT1
glfT1
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) · Galactofuranosyltransferase GlfT1 (EC 2.4.1.287)
GT2Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT2 · CAZy entry |
|---|
| Gene symbol | glfT1 |
|---|
| Synonyms / alternate names | - Arabinogalactan galactosyltransferase 1
- Rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,4/1,5-galactofuranosyltransferase
- UDP-Galf:alpha-3-L-rhamnosyl-alpha-D-GlcNAc-pyrophosphate polyprenol, galactofuranosyl transferase
|
|---|
| UniProt accession | P9WMX3 |
|---|
| NCBI Gene ID | 886114 |
|---|
| Source species | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Galactofuranosyltransferase GlfT1 (EC 2.4.1.287) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Interacts with Rv3789. Is thus probably part of an AG biosyn |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | 2 UDP-alpha-D-galactofuranose |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | - alpha-L-rhamnosyl-(1->3)-N-acetyl-alpha-D-glucosaminyl-diphospho-trans
- octa-cis-decaprenol
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
304 aa
MTESVFAVVVTHRRPDELAKSLDVLTAQTRLPDHLIVVDNDGCGDSPVRELVAGQPIATTYLGSRRNLGGAGGFALGMLHALAQGADWVWLADDDGHAQDARVLATLLACAEKYSLAEVSPMVCNIDDPTRLAFPLRRGLVWRRRASELRTEAGQELLPGIASLFNGALFRASTLAAIGVPDLRLFIRGDEVEMHRRLIRSGLPFGTCLDAAYLHPCGSDEFKPILCGRMHAQYPDDPGKRFFTYRNRGYVLSQPGLRKLLAQEWLRFGWFFLVTRRDPKGLWEWIRLRRLGRREKFGKPGGSA
Catalytic domain sequence
109 aa
VVVTHRRPDELAKSLDVLTAQTRLPDHLIVVDNDGCGDSPVRELVAGQPIATTYLGSRRNLGGAGGFALGMLHALAQGADWVWLADDDGHAQDARVLATLLACAEKYSL
