Home/GT Families/GT2/tarP
tarP
Staphylococcus aureus (strain N315) · Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarP (EC 2.4.1.-)
GT2Model organism · annotation ≥ 4Fold GT-AInverting6 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT2 · CAZy entry |
|---|
| Gene symbol | tarP |
|---|
| Synonyms / alternate names | WTA glycosyltransferase |
|---|
| UniProt accession | A0A0H3JNB0 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Staphylococcus aureus (strain N315) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarP (EC 2.4.1.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | homotrimer |
|---|
| PDB structures | 6H1J, 6H21, 6H2N, 6H4F, 6H4M, 6HNQ |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | n UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | - 4-O-[(D-ribitylphospho)(n)-di{(2R)-glycerylphospho}]-N-acetyl-beta-D-mannosaminyl-(1->4)-N-acetyl-alpha-D-glucosaminyl di-trans
- octa-cis-undecaprenyl diphosphate
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
327 aa
MKKVSVIMPTFNNGEKLHRTISSVLNQTMKSTDYELIIIDDHSNDNGETLNVIKKYKGLVRFKQLKKNSGNASVPRNTGLKMSKAEYVFFLDSDDLLHERALEDLYNYGKENNSDLIIGKYGVEGKGRSVPKAIFEKGNVAKADIIDNSIFYALSVLKMFKKSVIDKNKIKFKTFSKTAEDQLFTIEFLMNSKNYSIKTDYEYYIVVNDFESSNHLSVNKSTGNQYFATINEIYKAIYKSPIYKNQEKRHQLAGKYTTRLLRHGQKKNFANSKMKYEDKIEWLNNFSKTINKVPRDSDKYVTQIFNLKLEAIRQNDLLAVMIADKLL
Catalytic domain sequence
149 aa
VIMPTFNNGEKLHRTISSVLNQTMKSTDYELIIIDDHSNDNGETLNVIKKYKGLVRFKQLKKNSGNASVPRNTGLKMSKAEYVFFLDSDDLLHERALEDLYNYGKENNSDLIIGKYGVEGKGRSVPKAIFEKGNVAKADIIDNSIFYAL
