Home/GT Families/GT31/B3GNT2
B3GNT2
Homo sapiens · N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (EC 2.4.1.149)
GT31Model organism · annotation ≥ 4Fold GT-AInverting12 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
|---|
| Gene symbol | B3GNT2 |
|---|
| Synonyms / alternate names | - B3GALT7
- B3GNT1
- Beta-1,3-N-acetylglucosaminyltransferase 1
- Beta-1,3-galactosyltransferase 7
- Beta-3-Gx-T7
- UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 7
- UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
- UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 7
|
|---|
| UniProt accession | Q9NY97 |
|---|
| NCBI Gene ID | 10678 |
|---|
| Source species | Homo sapiens |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (EC 2.4.1.149) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | Interacts with B3GNT8; this interaction greatly increases B3 |
|---|
| PDB structures | 6WMM, 6WMN, 6WMO, 7JHI, 7JHK, 7JHL, 7JHM, 7JHN, 7JHO, 8SZ3, 8TIC, 8TJC |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
397 aa
MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
Catalytic domain sequence
192 aa
ARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVP
