GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

rfng

Danio rerio · Beta-1,3-N-acetylglucosaminyltransferase radical fringe (EC 2.4.1.222)

GT31Model organism · annotation ≥ 4Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT31 · CAZy entry
Gene symbolrfng
Synonyms / alternate namesO-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
UniProt accessionQ6KFX9
NCBI Gene IDnot curated
Source speciesDanio rerio
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionBeta-1,3-N-acetylglucosaminyltransferase radical fringe (EC 2.4.1.222)
Subcellular locationGolgi apparatus membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorUDP-N-acetyl-alpha-D-glucosamine
Donor CCD code(s)UD1
Acceptor substrate(s)
  • 3-O-(alpha-L-fucosyl)-L-threonyl-[EGF-like domain protein]
  • 3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein]
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

362 aa
MHLSHVASNKTCFLLSLAFCALLVLLIPSLQPPQRQADLPQPRPHAKPAKHPLKNSLYRPNEDTRGGGFTQTPPPDNLEKMDDLNSHYRDFLDLRDIFIAVKTTRKYHKSRLQLLSQTWVSRAKEQTFIFTDGEDKELRLKAGLNIINTNCSAAHTRQALCCKMSVEYDKFIESQKKWFCHVDDDNYVILPSLLELLSSYSHTQDVYLGRPSLDHPIEAAERVKSDGSVSVKFWFATGGAGFCISRGLALKMSPWASLGNFITTAEKIRLPDDCTIGYIIEALLEVPLTHTGLFHSHLENLQRLPAENILRQVTLSYGGFENRRNVVSVGGAFSLAEDPTRFKTVHCKLYPDTEWCPRKTRH

Catalytic domain sequence

261 aa
DLRDIFIAVKTTRKYHKSRLQLLSQTWVSRAKEQTFIFTDGEDKELRLKAGLNIINTNCSAAHTRQALCCKMSVEYDKFIESQKKWFCHVDDDNYVILPSLLELLSSYSHTQDVYLGRPSLDHPIEAAERVKSDGSVSVKFWFATGGAGFCISRGLALKMSPWASLGNFITTAEKIRLPDDCTIGYIIEALLEVPLTHTGLFHSHLENLQRLPAENILRQVTLSYGGFENRRNVVSVGGAFSLAEDPTRFKTVHCKLYPDT