Home/GT Families/GT31/rfng
rfng
Danio rerio · Beta-1,3-N-acetylglucosaminyltransferase radical fringe (EC 2.4.1.222)
GT31Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
| Gene symbol | rfng |
| Synonyms / alternate names | O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase |
| UniProt accession | Q6KFX9 |
| NCBI Gene ID | not curated |
| Source species | Danio rerio |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Beta-1,3-N-acetylglucosaminyltransferase radical fringe (EC 2.4.1.222) |
| Subcellular location | Golgi apparatus membrane |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Inverting |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
| Donor CCD code(s) | UD1 |
| Acceptor substrate(s) | - 3-O-(alpha-L-fucosyl)-L-threonyl-[EGF-like domain protein]
- 3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein]
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
362 aa
MHLSHVASNKTCFLLSLAFCALLVLLIPSLQPPQRQADLPQPRPHAKPAKHPLKNSLYRPNEDTRGGGFTQTPPPDNLEKMDDLNSHYRDFLDLRDIFIAVKTTRKYHKSRLQLLSQTWVSRAKEQTFIFTDGEDKELRLKAGLNIINTNCSAAHTRQALCCKMSVEYDKFIESQKKWFCHVDDDNYVILPSLLELLSSYSHTQDVYLGRPSLDHPIEAAERVKSDGSVSVKFWFATGGAGFCISRGLALKMSPWASLGNFITTAEKIRLPDDCTIGYIIEALLEVPLTHTGLFHSHLENLQRLPAENILRQVTLSYGGFENRRNVVSVGGAFSLAEDPTRFKTVHCKLYPDTEWCPRKTRH
Catalytic domain sequence
261 aa
DLRDIFIAVKTTRKYHKSRLQLLSQTWVSRAKEQTFIFTDGEDKELRLKAGLNIINTNCSAAHTRQALCCKMSVEYDKFIESQKKWFCHVDDDNYVILPSLLELLSSYSHTQDVYLGRPSLDHPIEAAERVKSDGSVSVKFWFATGGAGFCISRGLALKMSPWASLGNFITTAEKIRLPDDCTIGYIIEALLEVPLTHTGLFHSHLENLQRLPAENILRQVTLSYGGFENRRNVVSVGGAFSLAEDPTRFKTVHCKLYPDT