Home/GT Families/GT4/tagE
tagE
Bacillus subtilis (strain 168) · Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)
GT4Model organism · annotation ≥ 4Fold GT-BRetaining
External resources
Identification and annotation
| CAZy family | GT4 · CAZy entry |
|---|
| Gene symbol | tagE |
|---|
| Synonyms / alternate names | - gtaA
- rodD
- Major teichoic acid biosynthesis protein E
|
|---|
| UniProt accession | P13484 |
|---|
| NCBI Gene ID | 936804 |
|---|
| Source species | Bacillus subtilis (strain 168) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | n UDP-alpha-D-glucose |
|---|
| Donor CCD code(s) | UPG |
|---|
| Acceptor substrate(s) | 4-O-{[(2R)-1-glycerylphospho](n)-(2R)-1-glycerylphospho}-N-acetyl-beta-D-mannosaminyl-(1->4)-N-acetyl-alpha-D-glucosaminyl undecaprenyl diphosphate |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
673 aa
MSLHAVSESNIKQIPDMDYYFISGGLPSNYGGLTKSLLLRSKLFGEECNQNTFFLTFRFDLELSSKIDELYSNGKIDKKFTSVINLFDDFLSVRTNGKRSYEERIGLDQIKKQVGMGKFAKTLLRLFGKKNNEMSVVYYGDGETIRYVDYWNDKNQLIKREEYTKNGNLVLVTHYDVQLNKMYLQEYINDQNQVYLDKLYVWNNEEKDVQLSHIIWYSLEGEIKVKDESELRQYWIEYLQKQNDKPKLFLVDSRPQDKHVFKVKKSPSSYYGAIIHNKHYGSNKYQIKGRYKEVFSQMYNLDAVFFITEEQLEDFKLISGEQETFFFTPHTIDKPLDPAVLNVPSEKYKAVIISRLASMKNLIHAVKAFSLVVKEIPEAKLDIFGSGEDFEKIKKEIEDTKLQNNVFLKGYTDNPDSEFQKAWLTISTSHFEGFGLSNMEALSNGCPVVTYDYDYGARSLVTDGANGYVIEQYNIEKLGQAIISLMKDESTHQKFSEQAFKMAEKYSRPNYIENWAFALNQMIEVRIEREKFSKKVGKKDPSISSYTEDFDKTKIEIDIENFDHNDIKKIRLVGLDRKNKAEIISTNLQNDQLFVIDLEKDVNIEKIAANKTQVIDFYIVFNANGHIKTMRRLSSEETKLSGNSIDTNNGYRVEPYTTVKGNFSWRVTEIKES
Catalytic domain sequence
167 aa
PLDPAVLNVPSEKYKAVIISRLASMKNLIHAVKAFSLVVKEIPEAKLDIFGSGEDFEKIKKEIEDTKLQNNVFLKGYTDNPDSEFQKAWLTISTSHFEGFGLSNMEALSNGCPVVTYDYDYGARSLVTDGANGYVIEQYNIEKLGQAIISLMKDESTHQKFSEQAFK
