Home/GT Families/GT7/beta4GalT7
beta4GalT7
Drosophila melanogaster · Beta-1,4-galactosyltransferase 7 (EC 2.4.1.133)
GT7Model organism · annotation ≥ 4Fold GT-AInverting4 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT7 · CAZy entry |
|---|
| Gene symbol | beta4GalT7 |
|---|
| Synonyms / alternate names | - beta-4GalT7
- beta4Gal-T7
- betaGalT7
- dbeta4GalTI
- Proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I
- Xylosylprotein beta 4-galactosyltransferase
|
|---|
| UniProt accession | Q9VBZ9 |
|---|
| NCBI Gene ID | 42991 |
|---|
| Source species | Drosophila melanogaster |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Beta-1,4-galactosyltransferase 7 (EC 2.4.1.133) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | 3LW6, 4LW3, 4LW6, 4M4K |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
|---|
| Donor CCD code(s) | GDU |
|---|
| Acceptor substrate(s) | 3-O-(beta-D-xylosyl)-L-seryl-[protein] |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
322 aa
MVNISTINWVFVCGLSFCLGGIAVLSLMPLGSDCVCPLSNPLAKLAGGGEGVSVIKKEPADEKQPQPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCSGTAAAASAVQT
Catalytic domain sequence
225 aa
HKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTILNILLD
