Home/GT Families/GT2/glfT1
glfT1
Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) · Galactofuranosyltransferase GlfT1 (EC 2.4.1.287)
GT2Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT2 · CAZy entry |
| Gene symbol | glfT1 |
| Synonyms / alternate names | - Arabinogalactan galactosyltransferase 1
- Rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,4/1,5-galactofuranosyltransferase
- UDP-Galf:alpha-3-L-rhamnosyl-alpha-D-GlcNAc-pyrophosphate polyprenol, galactofuranosyl transferase
|
| UniProt accession | A0R5Z2 |
| NCBI Gene ID | 93460980 |
| Source species | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) |
| Taxonomic domain | Bacteria |
| UniProt annotation level | 4 |
Function and localisation
| Enzyme function | Galactofuranosyltransferase GlfT1 (EC 2.4.1.287) |
| Subcellular location | not curated |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Inverting |
| Cation dependence | No |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | 2 UDP-alpha-D-galactofuranose |
| Donor CCD code(s) | not curated |
| Acceptor substrate(s) | - alpha-L-rhamnosyl-(1->3)-N-acetyl-alpha-D-glucosaminyl-diphospho-trans
- octa-cis-decaprenol
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
302 aa
MTHTEVVCAVVVTHRRRELLATSLDAVVSQDRKPDHLIVVDNDNDPQVRELVTGQPVPSTYLGSRRNLGGAGGFALGMLHALALGADWIWLADDDGRPADTTVLSTLLSCAHTHSLAEVSPMVCNLDDPQRLAFPLRRGLVWRRLTSELRTDSSSSSGDLLPGIASLFNGALFRADTVDAVGVPDLRLFVRGDEVELHRRLVRSGLPFGTCLTASYLHPCGTDEFKPILGGRMHTQYPDDETKRFFTYRNRGYLLSQPGLRKLLPQEWLRFGWYFLVSRRDLAGLREWIRLRRLGRRERFQR
Catalytic domain sequence
96 aa
AVVVTHRRRELLATSLDAVVSQDRKPDHLIVVDNDNDPQVRELVTGQPVPSTYLGSRRNLGGAGGFALGMLHALALGADWIWLADDDGRPADTTVL